PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10033630
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 310aa    MW: 34506.7 Da    PI: 6.3772
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10033630genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.87.6e-11179222548
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                  kr +r   NR +A+rsR RK+++i eLe+ v +L+ae + L  +
  Lus10033630 179 KRVKRILANRQSAQRSRVRKLQYISELERSVTSLQAEVSVLSPR 222
                  8999********************************98877655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-13175239IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.622177229IPR004827Basic-leucine zipper domain
PfamPF001702.6E-9179223IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.89E-11179233No hitNo description
Gene3DG3DSA:1.20.5.1704.7E-13179230No hitNo description
CDDcd147032.84E-23180230No hitNo description
PROSITE patternPS000360182197IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MAQLPPKIPT LPSWPDLSSD QKPHSAAAQP PSSAAAANNN HPSWVDEFLD FSSARRGTHR  60
RSASDSIAFL ETPLMTLDDD CRGGGGGRSS NNNGGSNNNH HNLQRHGQHD FDKFDDEQFM  120
SMFSVDDMSS NPGGSNSDDH DSINDDKEAA TTTGQSEDNS QQTTPSKGDN NGDRIFDPKR  180
VKRILANRQS AQRSRVRKLQ YISELERSVT SLQAEVSVLS PRVAFLDHQR LLLNVDNSAI  240
KQRIAALAQD KIFKDAHQEA LKREIERLRQ VYQHQSNKKM DHQTEQISNE PTPMTSTVDN  300
QKEQQLLQV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012079033.11e-118PREDICTED: basic leucine zipper 61-like
SwissprotQ9M2K46e-99BZP61_ARATH; Basic leucine zipper 61
TrEMBLA0A067K9X81e-118A0A067K9X8_JATCU; Uncharacterized protein
STRINGVIT_12s0028g02590.t011e-100(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20113488
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.17e-66bZIP family protein